PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00911.40
Common NameJCGZ_26427, LOC105648777, WRKY19
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family WRKY
Protein Properties Length: 163aa    MW: 18901.9 Da    PI: 8.7658
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00911.40genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.75.1e-3373131159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK+vk+s+fprsYY+Ct++gC+vkk+++r+++d+++v++tYeg H+h+
  Jcr4S00911.40  73 LDDGYRWRKYGQKTVKNSKFPRSYYKCTQNGCNVKKQIQRNTNDEEIVVTTYEGIHTHP 131
                    59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.0E-3359131IPR003657WRKY domain
SuperFamilySSF1182906.28E-2965132IPR003657WRKY domain
PROSITE profilePS5081129.95368133IPR003657WRKY domain
SMARTSM007746.3E-3773132IPR003657WRKY domain
PfamPF031067.3E-2774131IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MANLRIHFSD NENEESEITK HLDSNPINNN ICNIESGSSS RKSDNHIKAK TGKEKEITKH  60
RYAFQTRSQV DILDDGYRWR KYGQKTVKNS KFPRSYYKCT QNGCNVKKQI QRNTNDEEIV  120
VTTYEGIHTH PTQISTDNFE DIIIKQMQSY TFLSNAQSSA YAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A9e-2963130774Probable WRKY transcription factor 4
2lex_A9e-2963130774Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC4852711e-156KC485271.1 Jatropha curcas WRKY transcription factor 19 (WRKY19) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012090665.11e-120PREDICTED: probable WRKY transcription factor 75 isoform X1
SwissprotQ9FYA21e-48WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLS5CS521e-120S5CS52_JATCU; Uncharacterized protein
STRINGPOPTR_0012s10290.19e-55(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.19e-50WRKY DNA-binding protein 75
Publications ? help Back to Top
  1. Xiong W, et al.
    Genome-wide analysis of the WRKY gene family in physic nut (Jatropha curcas L.).
    Gene, 2013. 524(2): p. 124-32
    [PMID:23644253]
  2. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]